SCOPe 2.06: Domain d2kdga1: 2kdg A:249-344

Lineage for d2kdga1 (2kdg A:249-344)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)

8. Domain d2kdga1: 2kdg A:249-344 [242469]
   Other proteins in same PDB: d2kdga2
   automated match to d3puca_

Details for d2kdga1

PDB Entry: 2kdg

PDB Description: solution structure of the 1st ig domain of myotilin

PDB Compounds: (A:) Myotilin

SCOPe Domain Sequences for d2kdga1:

Sequence; same for both SEQRES and ATOM records:

>d2kdga1 b.1.1.0 (A:249-344) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pprfiqvpenmsidegrfcrmdfkvsglpapdvswylngrtvqsddlhkmivsekglhsl
ifevvrasdagayacvaknrageatftvqldvlake

Timeline for d2kdga1:

• d2kdga1 first appeared in SCOPe 2.04, called d2kdga_
  
• d2kdga1 was called d2kdga_ in SCOPe 2.05
  
• d2kdga1 appears in SCOPe 2.07
  
• d2kdga1 appears in the current release, SCOPe 2.08