![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
![]() | Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
![]() | Protein automated matches [190118] (16 species) not a true protein |
![]() | Species African clawed frog (Xenopus laevis) [TaxId:8355] [255337] (1 PDB entry) |
![]() | Domain d2kdec_: 2kde C: [242466] automated match to d4auqc_ |
PDB Entry: 2kde (more details)
SCOPe Domain Sequences for d2kdec_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2kdec_ d.15.1.1 (C:) automated matches {African clawed frog (Xenopus laevis) [TaxId: 8355]} mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn iqkestlhlvlrlrgg
Timeline for d2kdec_: