SCOPe 2.05: Domain d2kdba_: 2kdb A:

Lineage for d2kdba_ (2kdb A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (9 families)

5. Family d.15.1.0: automated matches [191343] (1 protein)
   not a true family

6. Protein automated matches [190233] (11 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187090] (45 PDB entries)

8. Domain d2kdba_: 2kdb A: [242464]
   automated match to d1wgda_

Details for d2kdba_

PDB Entry: 2kdb

PDB Description: Solution Structure of human ubiquitin-like domain of Herpud2_9_85, Northeast Structural Genomics Consortium (NESG) target HT53A

PDB Compounds: (A:) Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 2 protein

SCOPe Domain Sequences for d2kdba_:

Sequence; same for both SEQRES and ATOM records:

>d2kdba_ d.15.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pvtliikapnqkysdqtiscflnwtvgklkthlsnvypskpltkdqrlvysgrllpdhlq
lkdilrkqdeyhmvhlv

Timeline for d2kdba_:

• d2kdba_ first appeared in SCOPe 2.04
  
• d2kdba_ appears in SCOPe 2.06
  
• d2kdba_ appears in the current release, SCOPe 2.08