SCOPe 2.06: Domain d2kcfa1: 2kcf A:3-36

Lineage for d2kcfa1 (2kcf A:3-36)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.72: WW domain-like [51044] (3 superfamilies)
   core: 3-stranded meander beta-sheet

4. Superfamily b.72.1: WW domain [51045] (2 families)

5. Family b.72.1.1: WW domain [51046] (13 proteins)

6. Protein Mitotic rotamase PIN1 [51047] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [51048] (37 PDB entries)

8. Domain d2kcfa1: 2kcf A:3-36 [242460]
   Other proteins in same PDB: d2kcfa2
   automated match to d1i6ca_

Details for d2kcfa1

PDB Entry: 2kcf

PDB Description: the nmr solution structure of the isolated apo pin1 ww domain

PDB Compounds: (A:) Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1

SCOPe Domain Sequences for d2kcfa1:

Sequence; same for both SEQRES and ATOM records:

>d2kcfa1 b.72.1.1 (A:3-36) Mitotic rotamase PIN1 {Human (Homo sapiens) [TaxId: 9606]}
klppgwekrmsrssgrvyyfnhitnasqwerpsg

Timeline for d2kcfa1:

• d2kcfa1 first appeared in SCOPe 2.04, called d2kcfa_
  
• d2kcfa1 was called d2kcfa_ in SCOPe 2.05
  
• d2kcfa1 appears in SCOPe 2.07
  
• d2kcfa1 appears in the current release, SCOPe 2.08