Class b: All beta proteins [48724] (149 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (21 families) |
Family b.29.1.5: Pentraxin (pentaxin) [49951] (2 proteins) |
Protein Serum amyloid P component (SAP) [49952] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [49953] (3 PDB entries) |
Domain d1lgne_: 1lgn E: [24246] complexed with apm, ca |
PDB Entry: 1lgn (more details), 2.8 Å
SCOP Domain Sequences for d1lgne_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lgne_ b.29.1.5 (E:) Serum amyloid P component (SAP) {Human (Homo sapiens)} htdlsgkvfvfpresvtdhvnlitplekplqnftlcfraysdlsrayslfsyntqgrdne llvykervgeyslyigrhkvtskviekfpapvhicvswesssgiaefwingtplvkkglr qgyfveaqpkivlgqeqdsyggkfdrsqsfvgeigdlymwdsvlppenilsayqgtplpa nildwqalnyeirgyviikplvwv
Timeline for d1lgne_:
View in 3D Domains from other chains: (mouse over for more information) d1lgna_, d1lgnb_, d1lgnc_, d1lgnd_ |