Class b: All beta proteins [48724] (180 folds) |
Fold b.36: PDZ domain-like [50155] (1 superfamily) contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix |
Superfamily b.36.1: PDZ domain-like [50156] (7 families) peptide-binding domain |
Family b.36.1.1: PDZ domain [50157] (47 proteins) Pfam PF00595 |
Protein automated matches [190055] (6 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187785] (51 PDB entries) |
Domain d2kbsa_: 2kbs A: [242457] automated match to d1x5na1 |
PDB Entry: 2kbs (more details)
SCOPe Domain Sequences for d2kbsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2kbsa_ b.36.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} kekkvfislvgsrglgcsissgpiqkpgifishvkpgslsaevgleigdqivevngvdfs nldhkeavnvlkssrsltisivaaagrelfmt
Timeline for d2kbsa_: