SCOPe 2.05: Domain d2kbmb_: 2kbm B:

Lineage for d2kbmb_ (2kbm B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.2: S100 proteins [47478] (2 proteins)
   dimer: subunits are made of two EF-hands

6. Protein Calcyclin (S100) [47479] (17 species)

7. Species Norway rat (Rattus norvegicus), s100a1 [TaxId:10116] [69019] (4 PDB entries)

8. Domain d2kbmb_: 2kbm B: [242456]
   automated match to d1k2ha_
   complexed with ca

Details for d2kbmb_

PDB Entry: 2kbm

PDB Description: ca-s100a1 interacting with trtk12

PDB Compounds: (B:) Protein S100-A1

SCOPe Domain Sequences for d2kbmb_:

Sequence; same for both SEQRES and ATOM records:

>d2kbmb_ a.39.1.2 (B:) Calcyclin (S100) {Norway rat (Rattus norvegicus), s100a1 [TaxId: 10116]}
gseletametlinvfhahsgkegdkyklskkelkdllqtelssfldvqkdadavdkimke
ldengdgevdfqefvvlvaaltvacnnffwens

Timeline for d2kbmb_:

• d2kbmb_ first appeared in SCOPe 2.04
  
• d2kbmb_ appears in SCOPe 2.06
  
• d2kbmb_ appears in the current release, SCOPe 2.08