Lineage for d2kbmb_ (2kbm B:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1489461Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1489462Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1489488Family a.39.1.2: S100 proteins [47478] (2 proteins)
    dimer: subunits are made of two EF-hands
  6. 1489489Protein Calcyclin (S100) [47479] (17 species)
  7. 1489653Species Norway rat (Rattus norvegicus), s100a1 [TaxId:10116] [69019] (4 PDB entries)
  8. 1489661Domain d2kbmb_: 2kbm B: [242456]
    automated match to d1k2ha_
    complexed with ca

Details for d2kbmb_

PDB Entry: 2kbm (more details)

PDB Description: ca-s100a1 interacting with trtk12
PDB Compounds: (B:) Protein S100-A1

SCOPe Domain Sequences for d2kbmb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2kbmb_ a.39.1.2 (B:) Calcyclin (S100) {Norway rat (Rattus norvegicus), s100a1 [TaxId: 10116]}
gseletametlinvfhahsgkegdkyklskkelkdllqtelssfldvqkdadavdkimke
ldengdgevdfqefvvlvaaltvacnnffwens

SCOPe Domain Coordinates for d2kbmb_:

Click to download the PDB-style file with coordinates for d2kbmb_.
(The format of our PDB-style files is described here.)

Timeline for d2kbmb_: