Lineage for d2kbga_ (2kbg A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2358952Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2359497Family b.1.2.0: automated matches [191562] (1 protein)
    not a true family
  6. 2359498Protein automated matches [190976] (4 species)
    not a true protein
  7. 2359522Species Human (Homo sapiens) [TaxId:9606] [188649] (56 PDB entries)
  8. 2359599Domain d2kbga_: 2kbg A: [242451]
    automated match to d1lwra_

Details for d2kbga_

PDB Entry: 2kbg (more details)

PDB Description: Solution structure of the second Fibronectin type-III module of NCAM2
PDB Compounds: (A:) Neural cell adhesion molecule 2

SCOPe Domain Sequences for d2kbga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2kbga_ b.1.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
repsppsihgqpssgksfklsitkqddggapileyivkyrskdkedqwlekkvqgnkdhi
ilehlqwtmgyevqitaanrlgyseptvyefsmppkpniikd

SCOPe Domain Coordinates for d2kbga_:

Click to download the PDB-style file with coordinates for d2kbga_.
(The format of our PDB-style files is described here.)

Timeline for d2kbga_: