| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) ![]() |
| Family b.1.2.0: automated matches [191562] (1 protein) not a true family |
| Protein automated matches [190976] (5 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [188649] (69 PDB entries) |
| Domain d2kbga_: 2kbg A: [242451] automated match to d1lwra_ |
PDB Entry: 2kbg (more details)
SCOPe Domain Sequences for d2kbga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2kbga_ b.1.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
repsppsihgqpssgksfklsitkqddggapileyivkyrskdkedqwlekkvqgnkdhi
ilehlqwtmgyevqitaanrlgyseptvyefsmppkpniikd
Timeline for d2kbga_: