| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
| Protein automated matches [190123] (158 species) not a true protein |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [225477] (15 PDB entries) |
| Domain d2kbea_: 2kbe A: [242450] automated match to d3fhcb_ protein/RNA complex |
PDB Entry: 2kbe (more details)
SCOPe Domain Sequences for d2kbea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2kbea_ c.37.1.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
yevkvkladiqadpnsplysaksfdelglapellkgiyamkfqkpskiqeralplllhnp
prnmiaqsqsgtgktaafsltmltrvnpedaspqaiclapsrelarqtlevvqemgkftk
itsqlivpdsfeknkqinaqvivgtpgtvldlmrrklmqlqkikifvldeadnmldqqgl
gdqcirvkrflpkdtqlvlfsatfadavrqyakkivpnantlelqt
Timeline for d2kbea_: