Lineage for d1lgnd_ (1lgn D:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 459805Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 459806Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (21 families) (S)
  5. 460391Family b.29.1.5: Pentraxin (pentaxin) [49951] (2 proteins)
  6. 460419Protein Serum amyloid P component (SAP) [49952] (1 species)
  7. 460420Species Human (Homo sapiens) [TaxId:9606] [49953] (3 PDB entries)
  8. 460434Domain d1lgnd_: 1lgn D: [24245]

Details for d1lgnd_

PDB Entry: 1lgn (more details), 2.8 Å

PDB Description: decameric damp complex of human serum amyloid p component

SCOP Domain Sequences for d1lgnd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lgnd_ b.29.1.5 (D:) Serum amyloid P component (SAP) {Human (Homo sapiens)}
htdlsgkvfvfpresvtdhvnlitplekplqnftlcfraysdlsrayslfsyntqgrdne
llvykervgeyslyigrhkvtskviekfpapvhicvswesssgiaefwingtplvkkglr
qgyfveaqpkivlgqeqdsyggkfdrsqsfvgeigdlymwdsvlppenilsayqgtplpa
nildwqalnyeirgyviikplvwv

SCOP Domain Coordinates for d1lgnd_:

Click to download the PDB-style file with coordinates for d1lgnd_.
(The format of our PDB-style files is described here.)

Timeline for d1lgnd_: