SCOPe 2.05: Domain d2kb6a_: 2kb6 A:

Lineage for d2kb6a_ (2kb6 A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.5: RNase A-like [54075] (1 superfamily)
   contains long curved beta-sheet and 3 helices

4. Superfamily d.5.1: RNase A-like [54076] (2 families)
   can be classified as disulfide-rich

5. Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)

6. Protein automated matches [190061] (6 species)
   not a true protein

7. Species Frog (Rana pipiens) [TaxId:8404] [188156] (4 PDB entries)

8. Domain d2kb6a_: 2kb6 A: [242449]
   automated match to d3fd7a_

Details for d2kb6a_

PDB Entry: 2kb6

PDB Description: solution structure of onconase c87a/c104a

PDB Compounds: (A:) Protein P-30

SCOPe Domain Sequences for d2kb6a_:

Sequence; same for both SEQRES and ATOM records:

>d2kb6a_ d.5.1.1 (A:) automated matches {Frog (Rana pipiens) [TaxId: 8404]}
edwltfqkkhitntrdvdcdnimstnlfhckdkntfiysrpepvkaickgiiasknvltt
sefylsdcnvtsrpckyklkkstnkfavtcenqapvhfvgvgsa

Timeline for d2kb6a_:

• d2kb6a_ first appeared in SCOPe 2.04
  
• d2kb6a_ appears in SCOPe 2.06
  
• d2kb6a_ appears in the current release, SCOPe 2.08