SCOPe 2.08: Domain d2kb2a1: 2kb2 A:4-148

Lineage for d2kb2a1 (2kb2 A:4-148)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.10: Acylphosphatase/BLUF domain-like [54975] (4 families)

5. Family d.58.10.0: automated matches [191394] (1 protein)
   not a true family

6. Protein automated matches [190511] (8 species)
   not a true protein

7. Species Klebsiella pneumoniae [TaxId:272620] [255334] (1 PDB entry)

8. Domain d2kb2a1: 2kb2 A:4-148 [242447]
   Other proteins in same PDB: d2kb2a2
   automated match to d1x0pe_
   complexed with fmn

Details for d2kb2a1

PDB Entry: 2kb2

PDB Description: blrp1 bluf

PDB Compounds: (A:) BlrP1

SCOPe Domain Sequences for d2kb2a1:

Sequence; same for both SEQRES and ATOM records:

>d2kb2a1 d.58.10.0 (A:4-148) automated matches {Klebsiella pneumoniae [TaxId: 272620]}
mlttliyrsqvhpdrppvdldalvhrassknlplgitgillfnglqffqvlegteeales
lfseiqsdprhrdvvelmrdysayrrfhgtgmrildlrlfetdgaleeilrfstfgvtep
vndrmfrllsafiadggryclpepl

Timeline for d2kb2a1:

• d2kb2a1 first appeared in SCOPe 2.04, called d2kb2a_
  
• d2kb2a1 appears in SCOPe 2.07