Lineage for d2kaca_ (2kac A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2934642Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) (S)
  5. 2934643Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 proteins)
  6. 2934772Protein automated matches [190067] (6 species)
    not a true protein
  7. 2934790Species Peptostreptococcus magnus [TaxId:1260] [255308] (2 PDB entries)
  8. 2934792Domain d2kaca_: 2kac A: [242439]
    automated match to d1hz6a_
    mutant

Details for d2kaca_

PDB Entry: 2kac (more details)

PDB Description: nmr solution structure of kx6e protl mutant
PDB Compounds: (A:) protein l

SCOPe Domain Sequences for d2kaca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2kaca_ d.15.7.1 (A:) automated matches {Peptostreptococcus magnus [TaxId: 1260]}
meevtikanlifangstqtaefegtfeeatseayayadtleedngewtvdvadegytlni
efag

SCOPe Domain Coordinates for d2kaca_:

Click to download the PDB-style file with coordinates for d2kaca_.
(The format of our PDB-style files is described here.)

Timeline for d2kaca_: