Class g: Small proteins [56992] (100 folds) |
Fold g.53: TAZ domain [57932] (1 superfamily) all-alpha fold; Zn-binding sites are in the loops connecting helices |
Superfamily g.53.1: TAZ domain [57933] (1 family) automatically mapped to Pfam PF02135 |
Family g.53.1.1: TAZ domain [57934] (2 proteins) |
Protein automated matches [254574] (2 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [255332] (1 PDB entry) |
Domain d2ka6a_: 2ka6 A: [242438] automated match to d1f81a_ protein/DNA complex; complexed with zn |
PDB Entry: 2ka6 (more details)
SCOPe Domain Sequences for d2ka6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ka6a_ g.53.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} spqesrrlsiqrciqslvhacqcrnancslpscqkmkrvvqhtkgckrktnggcpvckql ialccyhakhcqenkcpvpfclnikhklrqqq
Timeline for d2ka6a_: