Lineage for d2ka6a_ (2ka6 A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3038292Fold g.53: TAZ domain [57932] (1 superfamily)
    all-alpha fold; Zn-binding sites are in the loops connecting helices
  4. 3038293Superfamily g.53.1: TAZ domain [57933] (1 family) (S)
    automatically mapped to Pfam PF02135
  5. 3038294Family g.53.1.1: TAZ domain [57934] (2 proteins)
  6. 3038308Protein automated matches [254574] (2 species)
    not a true protein
  7. 3038313Species Mouse (Mus musculus) [TaxId:10090] [255332] (1 PDB entry)
  8. 3038314Domain d2ka6a_: 2ka6 A: [242438]
    automated match to d1f81a_
    protein/DNA complex; complexed with zn

Details for d2ka6a_

PDB Entry: 2ka6 (more details)

PDB Description: nmr structure of the cbp-taz2/stat1-tad complex
PDB Compounds: (A:) creb-binding protein

SCOPe Domain Sequences for d2ka6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ka6a_ g.53.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
spqesrrlsiqrciqslvhacqcrnancslpscqkmkrvvqhtkgckrktnggcpvckql
ialccyhakhcqenkcpvpfclnikhklrqqq

SCOPe Domain Coordinates for d2ka6a_:

Click to download the PDB-style file with coordinates for d2ka6a_.
(The format of our PDB-style files is described here.)

Timeline for d2ka6a_: