SCOPe 2.05: Domain d2ka0a_: 2ka0 A:

Lineage for d2ka0a_ (2ka0 A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.62: Cyclophilin-like [50890] (1 superfamily)
   barrel, closed; n=8, S=10; complex topology

4. Superfamily b.62.1: Cyclophilin-like [50891] (5 families)

5. Family b.62.1.3: TM1367-like [141519] (2 proteins)
   Pfam PF04126; DUF369

6. Protein automated matches [254575] (1 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:2336] [255331] (1 PDB entry)

8. Domain d2ka0a_: 2ka0 A: [242433]
   automated match to d1zx8b_

Details for d2ka0a_

PDB Entry: 2ka0

PDB Description: nmr structure of the protein tm1367

PDB Compounds: (A:) uncharacterized protein TM1367

SCOPe Domain Sequences for d2ka0a_:

Sequence; same for both SEQRES and ATOM records:

>d2ka0a_ b.62.1.3 (A:) automated matches {Thermotoga maritima [TaxId: 2336]}
mrvellfesgkcvidlneeyevvkllkekipfesvvntwgeeiyfstpvnvqkmenprev
veigdvgywppgkalclffgktpmsddkiqpasavnvigkivegledlkkikdgekvavr
fass

Timeline for d2ka0a_:

• d2ka0a_ first appeared in SCOPe 2.04
  
• d2ka0a_ appears in SCOPe 2.06
  
• d2ka0a_ appears in the current release, SCOPe 2.08