Lineage for d2ka0a_ (2ka0 A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2397365Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 2397366Superfamily b.62.1: Cyclophilin-like [50891] (5 families) (S)
  5. 2397763Family b.62.1.3: TM1367-like [141519] (2 protein domains)
    Pfam PF04126; DUF369
  6. 2397769Protein automated matches [254575] (1 species)
    not a true protein
  7. 2397770Species Thermotoga maritima [TaxId:2336] [255331] (1 PDB entry)
  8. 2397771Domain d2ka0a_: 2ka0 A: [242433]
    automated match to d1zx8b_

Details for d2ka0a_

PDB Entry: 2ka0 (more details)

PDB Description: NMR structure of the protein TM1367
PDB Compounds: (A:) uncharacterized protein TM1367

SCOPe Domain Sequences for d2ka0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ka0a_ b.62.1.3 (A:) automated matches {Thermotoga maritima [TaxId: 2336]}
mrvellfesgkcvidlneeyevvkllkekipfesvvntwgeeiyfstpvnvqkmenprev
veigdvgywppgkalclffgktpmsddkiqpasavnvigkivegledlkkikdgekvavr
fass

SCOPe Domain Coordinates for d2ka0a_:

Click to download the PDB-style file with coordinates for d2ka0a_.
(The format of our PDB-style files is described here.)

Timeline for d2ka0a_: