SCOPe 2.06: Domain d2k9za_: 2k9z A:

Lineage for d2k9za_ (2k9z A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.8: Hypothetical protein TM1112 [89406] (1 protein)

6. Protein Hypothetical protein TM1112 [89407] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [89408] (3 PDB entries)

8. Domain d2k9za_: 2k9z A: [242432]
   automated match to d1lkna_

Details for d2k9za_

PDB Entry: 2k9z

PDB Description: nmr structure of the protein tm1112

PDB Compounds: (A:) uncharacterized protein TM1112

SCOPe Domain Sequences for d2k9za_:

Sequence; same for both SEQRES and ATOM records:

>d2k9za_ b.82.1.8 (A:) Hypothetical protein TM1112 {Thermotoga maritima [TaxId: 2336]}
mevkiekptpeklkelsvekwpiwekevsefdwyydtnetcyilegkvevttedgkkyvi
ekgdlvtfpkglrcrwkvlepvrkhynlf

Timeline for d2k9za_:

• d2k9za_ first appeared in SCOPe 2.04
  
• d2k9za_ appears in SCOPe 2.05
  
• d2k9za_ appears in SCOPe 2.07
  
• d2k9za_ appears in the current release, SCOPe 2.08