SCOPe 2.04: Domain d2k9na2: 2k9n A:50-107

Lineage for d2k9na2 (2k9n A:50-107)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (20 families)
   consists only of helices

5. Family a.4.1.0: automated matches [191447] (1 protein)
   not a true family

6. Protein automated matches [190674] (14 species)
   not a true protein

7. Species Trichomonas vaginalis [TaxId:5722] [233124] (4 PDB entries)

8. Domain d2k9na2: 2k9n A:50-107 [242430]
   automated match to d3osga2

Details for d2k9na2

PDB Entry: 2k9n

PDB Description: solution nmr structure of the r2r3 dna binding domain of myb1 protein from protozoan parasite trichomonas vaginalis

PDB Compounds: (A:) myb24

SCOPe Domain Sequences for d2k9na2:

Sequence; same for both SEQRES and ATOM records:

>d2k9na2 a.4.1.0 (A:50-107) automated matches {Trichomonas vaginalis [TaxId: 5722]}
alrtdpwspeedmlldqkyaeygpkwnkiskflknrsdnnirnrwmmiarhrakhqks

Timeline for d2k9na2:

• d2k9na2 is new in SCOPe 2.04-stable
  
• d2k9na2 appears in SCOPe 2.05
  
• d2k9na2 appears in the current release, SCOPe 2.08