SCOPe 2.08: Domain d2k9ga1: 2k9g A:262-333

Lineage for d2k9ga1 (2k9g A:262-333)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.0: automated matches [191375] (1 protein)
   not a true family

6. Protein automated matches [190457] (10 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187598] (105 PDB entries)

8. Domain d2k9ga1: 2k9g A:262-333 [242428]
   Other proteins in same PDB: d2k9ga2
   automated match to d1ue9a_

Details for d2k9ga1

PDB Entry: 2k9g

PDB Description: Solution structure of the third SH3 domain of the Cin85 adapter protein

PDB Compounds: (A:) SH3 domain-containing kinase-binding protein 1

SCOPe Domain Sequences for d2k9ga1:

Sequence; same for both SEQRES and ATOM records:

>d2k9ga1 b.34.2.0 (A:262-333) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mdsrtkskdyckvifpyeaqnddeltikegdivtlinkdcidvgwwegelngrrgvfpdn
fvkllppdfeke

Timeline for d2k9ga1:

• d2k9ga1 first appeared in SCOPe 2.04, called d2k9ga_
  
• d2k9ga1 appears in SCOPe 2.07