Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.17: Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) [74863] (2 families) |
Family b.1.17.1: Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) [74864] (2 proteins) |
Protein Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) [74865] (2 species) |
Species Neisseria meningitidis [TaxId:491] [255329] (1 PDB entry) |
Domain d2k9fb1: 2k9f B:2-128 [242427] Other proteins in same PDB: d2k9fa_, d2k9fb2 automated match to d1vrsc_ |
PDB Entry: 2k9f (more details)
SCOPe Domain Sequences for d2k9fb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2k9fb1 b.1.17.1 (B:2-128) Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) {Neisseria meningitidis [TaxId: 491]} aldandllppekafvpelavaddgvnvrfriadgyymyqakivgktnpadllgqpsfskg eekedeffgrqtvyhheaqvafpyakavgepyklvltyqgsaeagvcyppvdtefdifgn gtyhpqt
Timeline for d2k9fb1: