SCOPe 2.04: Domain d2k9fb_: 2k9f B:

Lineage for d2k9fb_ (2k9f B:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.17: Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) [74863] (2 families)

5. Family b.1.17.1: Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) [74864] (2 proteins)

6. Protein Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) [74865] (2 species)

7. Species Neisseria meningitidis [TaxId:491] [255329] (1 PDB entry)

8. Domain d2k9fb_: 2k9f B: [242427]
   Other proteins in same PDB: d2k9fa_
   automated match to d1vrsc_

Details for d2k9fb_

PDB Entry: 2k9f

PDB Description: structural features of the complex between the dsbd n-terminal and the pilb n-terminal domains from neisseria meningitidis

PDB Compounds: (B:) Thiol:disulfide interchange protein dsbD

SCOPe Domain Sequences for d2k9fb_:

Sequence; same for both SEQRES and ATOM records:

>d2k9fb_ b.1.17.1 (B:) Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) {Neisseria meningitidis [TaxId: 491]}
maldandllppekafvpelavaddgvnvrfriadgyymyqakivgktnpadllgqpsfsk
geekedeffgrqtvyhheaqvafpyakavgepyklvltyqgsaeagvcyppvdtefdifg
ngtyhpqt

Timeline for d2k9fb_:

• d2k9fb_ is new in SCOPe 2.04-stable
  
• d2k9fb_ appears in SCOPe 2.05
  
• d2k9fb_ appears in the current release, SCOPe 2.08, called d2k9fb1