Lineage for d2k9fb1 (2k9f B:2-128)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2032092Superfamily b.1.17: Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) [74863] (2 families) (S)
  5. 2032093Family b.1.17.1: Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) [74864] (2 protein domains)
  6. 2032094Protein Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) [74865] (2 species)
  7. 2032105Species Neisseria meningitidis [TaxId:491] [255329] (1 PDB entry)
  8. 2032106Domain d2k9fb1: 2k9f B:2-128 [242427]
    Other proteins in same PDB: d2k9fa_, d2k9fb2
    automated match to d1vrsc_

Details for d2k9fb1

PDB Entry: 2k9f (more details)

PDB Description: Structural features of the complex between the DsbD N-terminal and the PilB N-terminal domains from Neisseria meningitidis
PDB Compounds: (B:) Thiol:disulfide interchange protein dsbD

SCOPe Domain Sequences for d2k9fb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2k9fb1 b.1.17.1 (B:2-128) Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) {Neisseria meningitidis [TaxId: 491]}
aldandllppekafvpelavaddgvnvrfriadgyymyqakivgktnpadllgqpsfskg
eekedeffgrqtvyhheaqvafpyakavgepyklvltyqgsaeagvcyppvdtefdifgn
gtyhpqt

SCOPe Domain Coordinates for d2k9fb1:

Click to download the PDB-style file with coordinates for d2k9fb1.
(The format of our PDB-style files is described here.)

Timeline for d2k9fb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2k9fb2
View in 3D
Domains from other chains:
(mouse over for more information)
d2k9fa_