SCOPe 2.05: Domain d2k9fa_: 2k9f A:

Lineage for d2k9fa_ (2k9f A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)

6. Protein Peptide methionine sulfoxide reductase MsrA/MsrB, N-terminal domain [142385] (2 species)

7. Species Neisseria meningitidis serogroup A [TaxId:65699] [142386] (4 PDB entries)
   Uniprot Q9JWM8 33-175

8. Domain d2k9fa_: 2k9f A: [242426]
   Other proteins in same PDB: d2k9fb_
   automated match to d2fy6a1

Details for d2k9fa_

PDB Entry: 2k9f

PDB Description: structural features of the complex between the dsbd n-terminal and the pilb n-terminal domains from neisseria meningitidis

PDB Compounds: (A:) thioredoxin

SCOPe Domain Sequences for d2k9fa_:

Sequence; same for both SEQRES and ATOM records:

>d2k9fa_ c.47.1.10 (A:) Peptide methionine sulfoxide reductase MsrA/MsrB, N-terminal domain {Neisseria meningitidis serogroup A [TaxId: 65699]}
mvphtlstlktadnrpasvylkkdkptlikfwaswcplclselgqtekwaqdakfssanl
itvaspgflhekkdgdfqkwyaglnypklpvvtdnggtiaqslnisvypswaligkdgdv
qrivkgsineaqalalirdpnadl

Timeline for d2k9fa_:

• d2k9fa_ first appeared in SCOPe 2.04
  
• d2k9fa_ appears in SCOPe 2.06
  
• d2k9fa_ appears in the current release, SCOPe 2.08