Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins) |
Protein Peptide methionine sulfoxide reductase MsrA/MsrB, N-terminal domain [142385] (2 species) |
Species Neisseria meningitidis serogroup A [TaxId:65699] [142386] (4 PDB entries) Uniprot Q9JWM8 33-175 |
Domain d2k9fa_: 2k9f A: [242426] Other proteins in same PDB: d2k9fb_ automated match to d2fy6a1 |
PDB Entry: 2k9f (more details)
SCOPe Domain Sequences for d2k9fa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2k9fa_ c.47.1.10 (A:) Peptide methionine sulfoxide reductase MsrA/MsrB, N-terminal domain {Neisseria meningitidis serogroup A [TaxId: 65699]} mvphtlstlktadnrpasvylkkdkptlikfwaswcplclselgqtekwaqdakfssanl itvaspgflhekkdgdfqkwyaglnypklpvvtdnggtiaqslnisvypswaligkdgdv qrivkgsineaqalalirdpnadl
Timeline for d2k9fa_: