Lineage for d2k9ca_ (2k9c A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2570195Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2570196Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2570846Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)
  6. 2571026Protein Macrophage elastase (MMP-12) [69780] (1 species)
  7. 2571027Species Human (Homo sapiens) [TaxId:9606] [69781] (58 PDB entries)
    Uniprot P39900 106-263 ! Uniprot P39900 106-264
  8. 2571125Domain d2k9ca_: 2k9c A: [242424]
    automated match to d1os9a_
    complexed with co

Details for d2k9ca_

PDB Entry: 2k9c (more details)

PDB Description: paramagnetic shifts in solid-state nmr of proteins to elicit structural information
PDB Compounds: (A:) Macrophage metalloelastase

SCOPe Domain Sequences for d2k9ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2k9ca_ d.92.1.11 (A:) Macrophage elastase (MMP-12) {Human (Homo sapiens) [TaxId: 9606]}
hyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfargahgdd
hafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighslglghssd
pkavmfptykyvdintfrlsaddirgiqslyg

SCOPe Domain Coordinates for d2k9ca_:

Click to download the PDB-style file with coordinates for d2k9ca_.
(The format of our PDB-style files is described here.)

Timeline for d2k9ca_: