| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) ![]() |
| Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins) |
| Protein Macrophage elastase (MMP-12) [69780] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [69781] (58 PDB entries) Uniprot P39900 106-263 ! Uniprot P39900 106-264 |
| Domain d2k9ca_: 2k9c A: [242424] automated match to d1os9a_ complexed with co |
PDB Entry: 2k9c (more details)
SCOPe Domain Sequences for d2k9ca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2k9ca_ d.92.1.11 (A:) Macrophage elastase (MMP-12) {Human (Homo sapiens) [TaxId: 9606]}
hyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfargahgdd
hafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighslglghssd
pkavmfptykyvdintfrlsaddirgiqslyg
Timeline for d2k9ca_: