![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
![]() | Superfamily a.28.1: ACP-like [47336] (4 families) ![]() |
![]() | Family a.28.1.1: Acyl-carrier protein (ACP) [47337] (7 proteins) |
![]() | Protein Acyl carrier protein [47338] (7 species) |
![]() | Species Escherichia coli [TaxId:562] [47339] (26 PDB entries) Uniprot P02901 |
![]() | Domain d2k94a_: 2k94 A: [242423] automated match to d1t8ka_ |
PDB Entry: 2k94 (more details)
SCOPe Domain Sequences for d2k94a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2k94a_ a.28.1.1 (A:) Acyl carrier protein {Escherichia coli [TaxId: 562]} stieervkkiigqqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipdeeae kittvqaaidyinghqa
Timeline for d2k94a_: