Lineage for d2k93a_ (2k93 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2316392Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 2316393Superfamily a.28.1: ACP-like [47336] (4 families) (S)
  5. 2316394Family a.28.1.1: Acyl-carrier protein (ACP) [47337] (7 protein domains)
  6. 2316399Protein Acyl carrier protein [47338] (7 species)
  7. 2316405Species Escherichia coli [TaxId:562] [47339] (16 PDB entries)
    Uniprot P02901
  8. 2316432Domain d2k93a_: 2k93 A: [242422]
    automated match to d1t8ka_

Details for d2k93a_

PDB Entry: 2k93 (more details)

PDB Description: Structural modification of acyl carrier protein by butyryl group
PDB Compounds: (A:) Acyl carrier protein

SCOPe Domain Sequences for d2k93a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2k93a_ a.28.1.1 (A:) Acyl carrier protein {Escherichia coli [TaxId: 562]}
stieervkkiigqqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipdeeae
kittvqaaidyinghqa

SCOPe Domain Coordinates for d2k93a_:

Click to download the PDB-style file with coordinates for d2k93a_.
(The format of our PDB-style files is described here.)

Timeline for d2k93a_: