SCOPe 2.08: Domain d2k8va1: 2k8v A:9-157

Lineage for d2k8va1 (2k8v A:9-157)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.1: Thioltransferase [52834] (16 proteins)

6. Protein automated matches [190442] (13 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189547] (7 PDB entries)

8. Domain d2k8va1: 2k8v A:9-157 [242420]
   Other proteins in same PDB: d2k8va2
   automated match to d1sena_

Details for d2k8va1

PDB Entry: 2k8v

PDB Description: solution structure of oxidised erp18

PDB Compounds: (A:) Thioredoxin domain-containing protein 12

SCOPe Domain Sequences for d2k8va1:

Sequence; same for both SEQRES and ATOM records:

>d2k8va1 c.47.1.1 (A:9-157) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sdghnglgkgfgdhihwrtledgkkeaaasglplmviihkswcgackalkpkfaesteis
elshnfvmvnledeeepkdedfspdggyiprilfldpsgkvhpeiinengnpsykyfyvs
aeqvvqgmkeaqerltgdafrkkhledel

Timeline for d2k8va1:

• d2k8va1 first appeared in SCOPe 2.04, called d2k8va_
  
• d2k8va1 appears in SCOPe 2.07