SCOP 1.75: Domain d1lgna_: 1lgn A:

Lineage for d1lgna_ (1lgn A:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families)

5. Family b.29.1.5: Pentraxin (pentaxin) [49951] (2 proteins)

6. Protein Serum amyloid P component (SAP) [49952] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49953] (6 PDB entries)

8. Domain d1lgna_: 1lgn A: [24242]

Details for d1lgna_

PDB Entry: 1lgn, 2.8 Å

PDB Description: decameric damp complex of human serum amyloid p component

PDB Compounds: (A:) serum amyloid p component

SCOP Domain Sequences for d1lgna_:

Sequence; same for both SEQRES and ATOM records:

>d1lgna_ b.29.1.5 (A:) Serum amyloid P component (SAP) {Human (Homo sapiens) [TaxId: 9606]}
htdlsgkvfvfpresvtdhvnlitplekplqnftlcfraysdlsrayslfsyntqgrdne
llvykervgeyslyigrhkvtskviekfpapvhicvswesssgiaefwingtplvkkglr
qgyfveaqpkivlgqeqdsyggkfdrsqsfvgeigdlymwdsvlppenilsayqgtplpa
nildwqalnyeirgyviikplvwv

Timeline for d1lgna_:

• d1lgna_ first appeared (with stable ids) in SCOP 1.55
  
• d1lgna_ appears in SCOP 1.73
  
• d1lgna_ appears in SCOPe 2.01
  
• d1lgna_ appears in the current release, SCOPe 2.08