Lineage for d1lgna_ (1lgn A:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 555832Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 555833Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (21 families) (S)
  5. 556441Family b.29.1.5: Pentraxin (pentaxin) [49951] (2 proteins)
  6. 556469Protein Serum amyloid P component (SAP) [49952] (1 species)
  7. 556470Species Human (Homo sapiens) [TaxId:9606] [49953] (3 PDB entries)
  8. 556481Domain d1lgna_: 1lgn A: [24242]

Details for d1lgna_

PDB Entry: 1lgn (more details), 2.8 Å

PDB Description: decameric damp complex of human serum amyloid p component

SCOP Domain Sequences for d1lgna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lgna_ b.29.1.5 (A:) Serum amyloid P component (SAP) {Human (Homo sapiens)}
htdlsgkvfvfpresvtdhvnlitplekplqnftlcfraysdlsrayslfsyntqgrdne
llvykervgeyslyigrhkvtskviekfpapvhicvswesssgiaefwingtplvkkglr
qgyfveaqpkivlgqeqdsyggkfdrsqsfvgeigdlymwdsvlppenilsayqgtplpa
nildwqalnyeirgyviikplvwv

SCOP Domain Coordinates for d1lgna_:

Click to download the PDB-style file with coordinates for d1lgna_.
(The format of our PDB-style files is described here.)

Timeline for d1lgna_: