Lineage for d2k8mc_ (2k8m C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2711591Family a.39.1.0: automated matches [191396] (1 protein)
    not a true family
  6. 2711592Protein automated matches [190513] (36 species)
    not a true protein
  7. 2711650Species Human (Homo sapiens) [TaxId:9606] [189519] (58 PDB entries)
  8. 2711732Domain d2k8mc_: 2k8m C: [242417]
    Other proteins in same PDB: d2k8ma1, d2k8ma2, d2k8md1, d2k8md2
    automated match to d2h2ka_

Details for d2k8mc_

PDB Entry: 2k8m (more details)

PDB Description: S100A13-C2A binary complex structure
PDB Compounds: (C:) Protein S100-A13

SCOPe Domain Sequences for d2k8mc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2k8mc_ a.39.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
maaeplteleesietvvttfftfarqegrkdslsvnefkelvtqqlphllkdvgsldekm
ksldvnqdselkfneywrligelakeirkkkdlkirkk

SCOPe Domain Coordinates for d2k8mc_:

Click to download the PDB-style file with coordinates for d2k8mc_.
(The format of our PDB-style files is described here.)

Timeline for d2k8mc_: