| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
| Family a.39.1.0: automated matches [191396] (1 protein) not a true family |
| Protein automated matches [190513] (36 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [189519] (58 PDB entries) |
| Domain d2k8mb_: 2k8m B: [242416] Other proteins in same PDB: d2k8ma1, d2k8ma2, d2k8md1, d2k8md2 automated match to d2h2ka_ |
PDB Entry: 2k8m (more details)
SCOPe Domain Sequences for d2k8mb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2k8mb_ a.39.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
maaeplteleesietvvttfftfarqegrkdslsvnefkelvtqqlphllkdvgsldekm
ksldvnqdselkfneywrligelakeirkkkdlkirkk
Timeline for d2k8mb_: