Class g: Small proteins [56992] (92 folds) |
Fold g.53: TAZ domain [57932] (1 superfamily) all-alpha fold; Zn-binding sites are in the loops connecting helices |
Superfamily g.53.1: TAZ domain [57933] (1 family) automatically mapped to Pfam PF02135 |
Family g.53.1.1: TAZ domain [57934] (2 proteins) |
Protein automated matches [254574] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [255328] (3 PDB entries) |
Domain d2k8fa_: 2k8f A: [242413] automated match to d1f81a_ protein/DNA complex; protein/RNA complex |
PDB Entry: 2k8f (more details)
SCOPe Domain Sequences for d2k8fa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2k8fa_ g.53.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} atqspgdsrrlsiqraiqslvhaaqcrnancslpscqkmkrvvqhtkgckrktnggcpic kqlialaayhakhcqenkcpvpfclnikqk
Timeline for d2k8fa_: