Lineage for d2k8fa_ (2k8f A:)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1967597Fold g.53: TAZ domain [57932] (1 superfamily)
    all-alpha fold; Zn-binding sites are in the loops connecting helices
  4. 1967598Superfamily g.53.1: TAZ domain [57933] (1 family) (S)
    automatically mapped to Pfam PF02135
  5. 1967599Family g.53.1.1: TAZ domain [57934] (2 proteins)
  6. 1967612Protein automated matches [254574] (2 species)
    not a true protein
  7. 1967613Species Human (Homo sapiens) [TaxId:9606] [255328] (3 PDB entries)
  8. 1967615Domain d2k8fa_: 2k8f A: [242413]
    automated match to d1f81a_
    protein/DNA complex; protein/RNA complex

Details for d2k8fa_

PDB Entry: 2k8f (more details)

PDB Description: structural basis for the regulation of p53 function by p300
PDB Compounds: (A:) Histone acetyltransferase p300

SCOPe Domain Sequences for d2k8fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2k8fa_ g.53.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
atqspgdsrrlsiqraiqslvhaaqcrnancslpscqkmkrvvqhtkgckrktnggcpic
kqlialaayhakhcqenkcpvpfclnikqk

SCOPe Domain Coordinates for d2k8fa_:

Click to download the PDB-style file with coordinates for d2k8fa_.
(The format of our PDB-style files is described here.)

Timeline for d2k8fa_: