| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
| Family a.4.5.14: Forkhead DNA-binding domain [46832] (7 proteins) |
| Protein automated matches [190243] (2 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187016] (11 PDB entries) |
| Domain d2k86a1: 2k86 A:151-251 [242410] Other proteins in same PDB: d2k86a2 automated match to d3co6c_ |
PDB Entry: 2k86 (more details)
SCOPe Domain Sequences for d2k86a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2k86a1 a.4.5.14 (A:151-251) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ssrrnawgnlsyadlitraiesspdkrltlsqiyewmvrcvpyfkdkgdsnssagwknsi
rhnlslhsrfmrvqnegtgksswwiinpdggksgkaprrra
Timeline for d2k86a1: