SCOPe 2.08: Domain d2k86a1: 2k86 A:151-251

Lineage for d2k86a1 (2k86 A:151-251)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.14: Forkhead DNA-binding domain [46832] (7 proteins)

6. Protein automated matches [190243] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187016] (11 PDB entries)

8. Domain d2k86a1: 2k86 A:151-251 [242410]
   Other proteins in same PDB: d2k86a2
   automated match to d3co6c_

Details for d2k86a1

PDB Entry: 2k86

PDB Description: solution structure of foxo3a forkhead domain

PDB Compounds: (A:) Forkhead box protein O3

SCOPe Domain Sequences for d2k86a1:

Sequence; same for both SEQRES and ATOM records:

>d2k86a1 a.4.5.14 (A:151-251) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ssrrnawgnlsyadlitraiesspdkrltlsqiyewmvrcvpyfkdkgdsnssagwknsi
rhnlslhsrfmrvqnegtgksswwiinpdggksgkaprrra

Timeline for d2k86a1:

• d2k86a1 first appeared in SCOPe 2.04, called d2k86a_
  
• d2k86a1 appears in SCOPe 2.07