Lineage for d2k86a1 (2k86 A:151-251)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2304501Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2305606Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2305937Family a.4.5.14: Forkhead DNA-binding domain [46832] (7 protein domains)
  6. 2305958Protein automated matches [190243] (2 species)
    not a true protein
  7. 2305959Species Human (Homo sapiens) [TaxId:9606] [187016] (8 PDB entries)
  8. 2305973Domain d2k86a1: 2k86 A:151-251 [242410]
    Other proteins in same PDB: d2k86a2
    automated match to d3co6c_

Details for d2k86a1

PDB Entry: 2k86 (more details)

PDB Description: Solution Structure of FOXO3a Forkhead domain
PDB Compounds: (A:) Forkhead box protein O3

SCOPe Domain Sequences for d2k86a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2k86a1 a.4.5.14 (A:151-251) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ssrrnawgnlsyadlitraiesspdkrltlsqiyewmvrcvpyfkdkgdsnssagwknsi
rhnlslhsrfmrvqnegtgksswwiinpdggksgkaprrra

SCOPe Domain Coordinates for d2k86a1:

Click to download the PDB-style file with coordinates for d2k86a1.
(The format of our PDB-style files is described here.)

Timeline for d2k86a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2k86a2