Class b: All beta proteins [48724] (141 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (20 families) |
Family b.29.1.5: Pentraxin (pentaxin) [49951] (2 proteins) |
Protein Serum amyloid P component (SAP) [49952] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [49953] (3 PDB entries) |
Domain d1sace_: 1sac E: [24241] complexed with acy, ca |
PDB Entry: 1sac (more details), 2 Å
SCOP Domain Sequences for d1sace_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sace_ b.29.1.5 (E:) Serum amyloid P component (SAP) {Human (Homo sapiens)} htdlsgkvfvfpresvtdhvnlitplekplqnftlcfraysdlsrayslfsyntqgrdne llvykervgeyslyigrhkvtskviekfpapvhicvswesssgiaefwingtplvkkglr qgyfveaqpkivlgqeqdsyggkfdrsqsfvgeigdlymwdsvlppenilsayqgtplpa nildwqalnyeirgyviikplvwv
Timeline for d1sace_:
View in 3D Domains from other chains: (mouse over for more information) d1saca_, d1sacb_, d1sacc_, d1sacd_ |