SCOPe 2.08: Domain d2k7va1: 2k7v A:2-89

Lineage for d2k7va1 (2k7v A:2-89)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
   sandwich of half-barrel shaped beta-sheets

4. Superfamily b.84.1: Single hybrid motif [51230] (2 families)
   7 to 8 strands in 2 beta-sheets

5. Family b.84.1.1: Biotinyl/lipoyl-carrier proteins and domains [51231] (7 proteins)

6. Protein automated matches [254572] (2 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [255326] (2 PDB entries)

8. Domain d2k7va1: 2k7v A:2-89 [242406]
   Other proteins in same PDB: d2k7va2, d2k7vb2
   automated match to d1qjoa_

Details for d2k7va1

PDB Entry: 2k7v

PDB Description: deletions in a surface loop divert the folding of a protein domain into a metastable dimeric form

PDB Compounds: (A:) Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex

SCOPe Domain Sequences for d2k7va1:

Sequence; same for both SEQRES and ATOM records:

>d2k7va1 b.84.1.1 (A:2-89) automated matches {Escherichia coli K-12 [TaxId: 83333]}
vkevnvpdivevtevmvkvgdkvaaeqslitvegdkasmevpapfagvvkelkvnvgdkv
ktgslimifevegaapaaapakqe

Timeline for d2k7va1:

• d2k7va1 first appeared in SCOPe 2.04, called d2k7va_
  
• d2k7va1 appears in SCOPe 2.07