Lineage for d2k7qa2 (2k7q A:2046-2141)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2375023Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2376005Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2376006Protein automated matches [190226] (72 species)
    not a true protein
  7. 2376172Species Human (Homo sapiens) [TaxId:9606] [186988] (10 PDB entries)
  8. 2376193Domain d2k7qa2: 2k7q A:2046-2141 [242404]
    Other proteins in same PDB: d2k7qa3
    automated match to d2j3sa1

Details for d2k7qa2

PDB Entry: 2k7q (more details)

PDB Description: filamin a ig-like domains 18-19
PDB Compounds: (A:) Filamin-A

SCOPe Domain Sequences for d2k7qa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2k7qa2 b.1.18.0 (A:2046-2141) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dasrvrvsgqglheghtfepaefiidtrdagygglslsiegpskvdintedledgtcrvt
ycptepgnyiinikfadqhvpgspfsvkvtgegrvk

SCOPe Domain Coordinates for d2k7qa2:

Click to download the PDB-style file with coordinates for d2k7qa2.
(The format of our PDB-style files is described here.)

Timeline for d2k7qa2: