| Class b: All beta proteins [48724] (178 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
| Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
| Protein automated matches [190226] (72 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [186988] (10 PDB entries) |
| Domain d2k7qa2: 2k7q A:2046-2141 [242404] Other proteins in same PDB: d2k7qa3 automated match to d2j3sa1 |
PDB Entry: 2k7q (more details)
SCOPe Domain Sequences for d2k7qa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2k7qa2 b.1.18.0 (A:2046-2141) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dasrvrvsgqglheghtfepaefiidtrdagygglslsiegpskvdintedledgtcrvt
ycptepgnyiinikfadqhvpgspfsvkvtgegrvk
Timeline for d2k7qa2: