SCOPe 2.05: Domain d2k7qa2: 2k7q A:2046-2141

Lineage for d2k7qa2 (2k7q A:2046-2141)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.0: automated matches [191341] (1 protein)
   not a true family

6. Protein automated matches [190226] (43 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186988] (10 PDB entries)

8. Domain d2k7qa2: 2k7q A:2046-2141 [242404]
   automated match to d2j3sa1

Details for d2k7qa2

PDB Entry: 2k7q

PDB Description: filamin a ig-like domains 18-19

PDB Compounds: (A:) Filamin-A

SCOPe Domain Sequences for d2k7qa2:

Sequence; same for both SEQRES and ATOM records:

>d2k7qa2 b.1.18.0 (A:2046-2141) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dasrvrvsgqglheghtfepaefiidtrdagygglslsiegpskvdintedledgtcrvt
ycptepgnyiinikfadqhvpgspfsvkvtgegrvk

Timeline for d2k7qa2:

• d2k7qa2 first appeared in SCOPe 2.04
  
• d2k7qa2 appears in SCOPe 2.06
  
• d2k7qa2 appears in the current release, SCOPe 2.08