Lineage for d2k7qa1 (2k7q A:1954-2045)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2032114Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2033030Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2033031Protein automated matches [190226] (54 species)
    not a true protein
  7. 2033167Species Human (Homo sapiens) [TaxId:9606] [186988] (10 PDB entries)
  8. 2033187Domain d2k7qa1: 2k7q A:1954-2045 [242403]
    Other proteins in same PDB: d2k7qa3
    automated match to d2j3sa2

Details for d2k7qa1

PDB Entry: 2k7q (more details)

PDB Description: Filamin A Ig-like domains 18-19
PDB Compounds: (A:) Filamin-A

SCOPe Domain Sequences for d2k7qa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2k7qa1 b.1.18.0 (A:1954-2045) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gddsmrmshlkvgsaadipinisetdlslltatvvppsgreepcllkrlrnghvgisfvp
ketgehlvhvkkngqhvasspipvvisqseig

SCOPe Domain Coordinates for d2k7qa1:

Click to download the PDB-style file with coordinates for d2k7qa1.
(The format of our PDB-style files is described here.)

Timeline for d2k7qa1: