Lineage for d2k7ob_ (2k7o B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2710100Family a.39.1.2: S100 proteins [47478] (2 proteins)
    dimer: subunits are made of two EF-hands
  6. 2710101Protein Calcyclin (S100) [47479] (17 species)
  7. 2710317Species Norway rat (Rattus norvegicus), s100b [TaxId:10116] [47481] (7 PDB entries)
  8. 2710319Domain d2k7ob_: 2k7o B: [242402]
    automated match to d1qlka_
    complexed with ca

Details for d2k7ob_

PDB Entry: 2k7o (more details)

PDB Description: ca2+-s100b, refined with rdcs
PDB Compounds: (B:) Protein S100-B

SCOPe Domain Sequences for d2k7ob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2k7ob_ a.39.1.2 (B:) Calcyclin (S100) {Norway rat (Rattus norvegicus), s100b [TaxId: 10116]}
selekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmetl
dedgdgecdfqefmafvsmvttacheffehe

SCOPe Domain Coordinates for d2k7ob_:

Click to download the PDB-style file with coordinates for d2k7ob_.
(The format of our PDB-style files is described here.)

Timeline for d2k7ob_: