![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
![]() | Superfamily a.39.1: EF-hand [47473] (12 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
![]() | Family a.39.1.2: S100 proteins [47478] (2 proteins) dimer: subunits are made of two EF-hands |
![]() | Protein Calcyclin (S100) [47479] (17 species) |
![]() | Species Norway rat (Rattus norvegicus), s100b [TaxId:10116] [47481] (7 PDB entries) |
![]() | Domain d2k7oa_: 2k7o A: [242401] automated match to d1qlka_ complexed with ca |
PDB Entry: 2k7o (more details)
SCOPe Domain Sequences for d2k7oa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2k7oa_ a.39.1.2 (A:) Calcyclin (S100) {Norway rat (Rattus norvegicus), s100b [TaxId: 10116]} selekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmetl dedgdgecdfqefmafvsmvttacheffehe
Timeline for d2k7oa_: