SCOPe 2.08: Domain d2k7oa_: 2k7o A:

Lineage for d2k7oa_ (2k7o A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.2: S100 proteins [47478] (2 proteins)
   dimer: subunits are made of two EF-hands

6. Protein Calcyclin (S100) [47479] (17 species)

7. Species Norway rat (Rattus norvegicus), s100b [TaxId:10116] [47481] (7 PDB entries)

8. Domain d2k7oa_: 2k7o A: [242401]
   automated match to d1qlka_
   complexed with ca

Details for d2k7oa_

PDB Entry: 2k7o

PDB Description: ca2+-s100b, refined with rdcs

PDB Compounds: (A:) Protein S100-B

SCOPe Domain Sequences for d2k7oa_:

Sequence; same for both SEQRES and ATOM records:

>d2k7oa_ a.39.1.2 (A:) Calcyclin (S100) {Norway rat (Rattus norvegicus), s100b [TaxId: 10116]}
selekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmetl
dedgdgecdfqefmafvsmvttacheffehe

Timeline for d2k7oa_:

• d2k7oa_ first appeared in SCOPe 2.04
  
• d2k7oa_ appears in SCOPe 2.07