Lineage for d2k7ka1 (2k7k A:2-99)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2196354Superfamily d.58.10: Acylphosphatase/BLUF domain-like [54975] (3 families) (S)
  5. 2196355Family d.58.10.1: Acylphosphatase-like [54976] (4 proteins)
    automatically mapped to Pfam PF00708
  6. 2196375Protein automated matches [191024] (3 species)
    not a true protein
  7. 2196376Species Human (Homo sapiens) [TaxId:9606] [188822] (6 PDB entries)
  8. 2196382Domain d2k7ka1: 2k7k A:2-99 [242400]
    Other proteins in same PDB: d2k7ka2
    automated match to d2acya_

Details for d2k7ka1

PDB Entry: 2k7k (more details)

PDB Description: human acylphosphatase (acph) common type
PDB Compounds: (A:) acylphosphatase-1

SCOPe Domain Sequences for d2k7ka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2k7ka1 d.58.10.1 (A:2-99) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aegntlisvdyeifgkvqgvffrkhtqaegkklglvgwvqntdrgtvqgqlqgpiskvrh
mqewletrgspkshidkanfnnekvilkldysdfqivk

SCOPe Domain Coordinates for d2k7ka1:

Click to download the PDB-style file with coordinates for d2k7ka1.
(The format of our PDB-style files is described here.)

Timeline for d2k7ka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2k7ka2