SCOPe 2.05: Domain d2k7ka_: 2k7k A:

Lineage for d2k7ka_ (2k7k A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.10: Acylphosphatase/BLUF domain-like [54975] (3 families)

5. Family d.58.10.1: Acylphosphatase-like [54976] (4 proteins)
   automatically mapped to Pfam PF00708

6. Protein automated matches [191024] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188822] (6 PDB entries)

8. Domain d2k7ka_: 2k7k A: [242400]
   automated match to d2acya_

Details for d2k7ka_

PDB Entry: 2k7k

PDB Description: human acylphosphatase (acph) common type

PDB Compounds: (A:) acylphosphatase-1

SCOPe Domain Sequences for d2k7ka_:

Sequence; same for both SEQRES and ATOM records:

>d2k7ka_ d.58.10.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gaegntlisvdyeifgkvqgvffrkhtqaegkklglvgwvqntdrgtvqgqlqgpiskvr
hmqewletrgspkshidkanfnnekvilkldysdfqivk

Timeline for d2k7ka_:

• d2k7ka_ first appeared in SCOPe 2.04
  
• d2k7ka_ is called d2k7ka1 in SCOPe 2.06
  
• d2k7ka_ appears in the current release, SCOPe 2.08, called d2k7ka1