| Class b: All beta proteins [48724] (180 folds) |
| Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
| Family b.29.1.5: Pentraxin (pentaxin) [49951] (2 proteins) automatically mapped to Pfam PF00354 |
| Protein Serum amyloid P component (SAP) [49952] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [49953] (12 PDB entries) |
| Domain d1sacd_: 1sac D: [24240] complexed with acy, ca |
PDB Entry: 1sac (more details), 2 Å
SCOPe Domain Sequences for d1sacd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sacd_ b.29.1.5 (D:) Serum amyloid P component (SAP) {Human (Homo sapiens) [TaxId: 9606]}
htdlsgkvfvfpresvtdhvnlitplekplqnftlcfraysdlsrayslfsyntqgrdne
llvykervgeyslyigrhkvtskviekfpapvhicvswesssgiaefwingtplvkkglr
qgyfveaqpkivlgqeqdsyggkfdrsqsfvgeigdlymwdsvlppenilsayqgtplpa
nildwqalnyeirgyviikplvwv
Timeline for d1sacd_:
View in 3DDomains from other chains: (mouse over for more information) d1saca_, d1sacb_, d1sacc_, d1sace_ |