Lineage for d2k7aa1 (2k7a A:171-231)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2782861Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2782862Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 2783254Protein automated matches [190043] (8 species)
    not a true protein
  7. 2783337Species Mouse (Mus musculus) [TaxId:10090] [187043] (7 PDB entries)
  8. 2783347Domain d2k7aa1: 2k7a A:171-231 [242393]
    Other proteins in same PDB: d2k7aa2, d2k7ab1, d2k7ab2
    automated match to d3h0ha_

Details for d2k7aa1

PDB Entry: 2k7a (more details)

PDB Description: ensemble structures of the binary complex between the sh3 and sh2 domain of interleukin-2 tyrosine kinase.
PDB Compounds: (A:) SH3 domain of Tyrosine-protein kinase ITK/TSK

SCOPe Domain Sequences for d2k7aa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2k7aa1 b.34.2.1 (A:171-231) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
peetlvialydyqtndpqelalrcdeeyylldsseihwwrvqdknghegyapssylveks
p

SCOPe Domain Coordinates for d2k7aa1:

Click to download the PDB-style file with coordinates for d2k7aa1.
(The format of our PDB-style files is described here.)

Timeline for d2k7aa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2k7aa2