SCOPe 2.08: Domain d2k79b1: 2k79 B:232-338

Lineage for d2k79b1 (2k79 B:232-338)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (2 families)

5. Family d.93.1.1: SH2 domain [55551] (35 proteins)
   Pfam PF00017

6. Protein Itk/tsk protein tyrosine kinase [82743] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [82744] (8 PDB entries)

8. Domain d2k79b1: 2k79 B:232-338 [242392]
   Other proteins in same PDB: d2k79a1, d2k79a2, d2k79b2
   automated match to d1oo4a_

Details for d2k79b1

PDB Entry: 2k79

PDB Description: solution structure of the binary complex between the sh3 and sh2 domain of interleukin-2 tyrosine kinase

PDB Compounds: (B:) SH2 domain of Tyrosine-protein kinase ITK/TSK

SCOPe Domain Sequences for d2k79b1:

Sequence; same for both SEQRES and ATOM records:

>d2k79b1 d.93.1.1 (B:232-338) Itk/tsk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]}
nnletyewynksisrdkaekllldtgkegafmvrdsrtpgtytvsvftkaiisenpcikh
yhiketndspkryyvaekyvfdsiplliqyhqynggglvtrlrypvc

Timeline for d2k79b1:

• d2k79b1 first appeared in SCOPe 2.04, called d2k79b_
  
• d2k79b1 appears in SCOPe 2.07