SCOPe 2.04: Domain d2k79a_: 2k79 A:

Lineage for d2k79a_ (2k79 A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.1: SH3-domain [50045] (40 proteins)

6. Protein automated matches [190043] (6 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [187043] (7 PDB entries)

8. Domain d2k79a_: 2k79 A: [242391]
   Other proteins in same PDB: d2k79b_
   automated match to d3h0ha_

Details for d2k79a_

PDB Entry: 2k79

PDB Description: solution structure of the binary complex between the sh3 and sh2 domain of interleukin-2 tyrosine kinase

PDB Compounds: (A:) SH3 domain of Tyrosine-protein kinase ITK/TSK

SCOPe Domain Sequences for d2k79a_:

Sequence; same for both SEQRES and ATOM records:

>d2k79a_ b.34.2.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gspeetlvialydyqtndpqelalrcdeeyylldsseihwwrvqdknghegyapssylve
ksp

Timeline for d2k79a_:

• d2k79a_ is new in SCOPe 2.04-stable
  
• d2k79a_ appears in SCOPe 2.05
  
• d2k79a_ appears in the current release, SCOPe 2.08, called d2k79a1