SCOPe 2.08: Domain d2k79a1: 2k79 A:171-231

Lineage for d2k79a1 (2k79 A:171-231)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.1: SH3-domain [50045] (40 proteins)

6. Protein automated matches [190043] (8 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [187043] (7 PDB entries)

8. Domain d2k79a1: 2k79 A:171-231 [242391]
   Other proteins in same PDB: d2k79a2, d2k79b1, d2k79b2
   automated match to d3h0ha_

Details for d2k79a1

PDB Entry: 2k79

PDB Description: solution structure of the binary complex between the sh3 and sh2 domain of interleukin-2 tyrosine kinase

PDB Compounds: (A:) SH3 domain of Tyrosine-protein kinase ITK/TSK

SCOPe Domain Sequences for d2k79a1:

Sequence; same for both SEQRES and ATOM records:

>d2k79a1 b.34.2.1 (A:171-231) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
peetlvialydyqtndpqelalrcdeeyylldsseihwwrvqdknghegyapssylveks
p

Timeline for d2k79a1:

• d2k79a1 first appeared in SCOPe 2.04, called d2k79a_
  
• d2k79a1 appears in SCOPe 2.07